This field studies the two inputs to growth-hormone release, GHRH and ghrelin, and what happens downstream in IGF-1 and tissue signaling. Three Artemis compounds appear in it. The page explains what the studies measure, which models they use, and lists the research articles.
Research Articles
What Is Sermorelin Studied For? Research Overview | Artemis Labs
Sermorelin is GHRH(1-29), the shortest fragment of growth hormone-releasing hormone that still works. Its human record is 1990s pediatric growth trials and adult physiology…
Read article →ArticleSermorelin and the WADA Prohibited List: The Exact Wording | Artemis Labs
The WADA 2026 Prohibited List names sermorelin, CJC-1295, tesamorelin and ipamorelin by name under section S2.2.4. Here is the entry, quoted from the List…
Read article →ArticleSermorelin vs CJC-1295 vs Ipamorelin: Three Records Compared | Artemis Labs
Sermorelin, CJC-1295 and ipamorelin are three different molecules, two receptors and three very different evidence bases. What each one's published record actually contains.
Read article →ArticleSermorelin Sequence, Structure and Molecular Weight | Artemis Labs
Sermorelin is GHRH(1-29) amide: 29 residues, molecular weight 3357.9, CAS 86168-78-7, PubChem CID 16132413. Why the brand name resolves to three other records, and…
Read article →ArticleSermorelin Safety Research: What the Trials Reported | Artemis Labs
What the sermorelin trials reported on safety: no adverse biochemical changes in the largest pediatric study, near-universal antibody formation in a randomized one, and…
Read article →ArticleSermorelin Human Trials: What the Record Actually Contains | Artemis Labs
Sermorelin's human trial record is 1990s pediatric growth studies and adult physiology work. In the one three-arm randomized comparison, growth hormone outgrew it and…
Read article →ArticleSermorelin, Desensitization and Antibodies: The Fading Response | Artemis Labs
Two findings run through the GHRH(1-29) literature and are rarely reported together: the pituitary becomes less responsive under continued stimulation, and treated children produced…
Read article →ArticleWhat Is Ipamorelin Studied For? The Research Record
Ipamorelin is a five-amino-acid peptide studied since 1998 for growth hormone release. Here is what the published research covers, in plain language, and what…
Read article →ArticleIpamorelin vs GHRP-2, GHRP-6 and Hexarelin: Research Compared
What published research reports when ipamorelin is measured head to head against GHRP-2, GHRP-6 and hexarelin: similar growth hormone release, different effects on other…
Read article →ArticleIpamorelin Sequence, Formula and Molecular Weight
Ipamorelin is a five-residue peptide, Aib-His-D-2-Nal-D-Phe-Lys-NH2, C38H49N9O5, molecular weight 711.9, CAS 170851-70-4. Why it is not a hexapeptide, and why two molecular weights circulate.
Read article →ArticleIpamorelin Selectivity: What the 1998 Research Showed
Ipamorelin's defining finding is that it released growth hormone in swine without raising ACTH or cortisol. Here is exactly what that study measured, and…
Read article →ArticleWhat Forensic Labs Found in Seized Ipamorelin
Two independent forensic laboratories identified glycine-modified ipamorelin in black-market and customs-seized material. What that finding means for anyone reading a specification sheet.
Read article →ArticleIpamorelin Human Trials: The Complete Record
Two human studies of ipamorelin exist. One measured pharmacokinetics in healthy volunteers; the other, a randomized placebo-controlled trial in 114 patients, found no difference…
Read article →ArticleIpamorelin and Gut Motility Research
The ghrelin receptor sits in the gut as well as the pituitary. Rodent studies of ipamorelin and bowel recovery led to the one human…
Read article →ArticleSermorelin in Adults: What Exists and What Is a Different Molecule | Artemis Labs
The adult sermorelin literature is mostly physiology probes. The two studies most often cited for aging tested a norleucine analog, not sermorelin, and the…
Read article →ArticleIpamorelin Bone and Muscle Research in Rats
Rat studies of ipamorelin measured bone length, bone mineral content and muscle tension. The results are more qualified than most summaries admit — including…
Read article →ArticleIs Sermorelin FDA-Approved? The Two Applications, Dated | Artemis Labs
Two FDA applications for sermorelin acetate exist, first approved December 28 1990 and September 26 1997, both discontinued with an FDA determination that it…
Read article →ArticleCJC-1295 and Ipamorelin Together: What the Record Contains | Artemis Labs
CJC-1295 and ipamorelin are sold as a pair. PubMed returns ten records mentioning both, all reviews, and no human study of the combination. What…
Read article →ArticleWhat Is Tesamorelin Studied For? Research Overview | Artemis Labs
Tesamorelin is a modified GHRH analog studied almost entirely in HIV-associated lipodystrophy, where a licensed product has a Phase 3 record. What the research…
Read article →ArticleTesamorelin vs Sermorelin: Two GHRH Analogs, Different Records | Artemis Labs
Tesamorelin and sermorelin are both GHRH analogs, but one is the full 44-residue hormone with a stabilizing cap and the other is a 29-residue…
Read article →ArticleTesamorelin Sequence, Structure and Molecular Weight | Artemis Labs
Tesamorelin is a 44-residue GHRH analog with a trans-3-hexenoyl group on Tyr1 and a C-terminal amide. One molecular weight (5136) is verified; the others…
Read article →ArticleTesamorelin Safety Research: Trials, FAERS and the Label’s Limits | Artemis Labs
What the tesamorelin safety record contains: the glucose composite, class-typical adverse events, a FAERS carpal-tunnel signal, sponsor animal toxicology, and the evidence that does…
Read article →ArticleTesamorelin Research Outside HIV: Where the Evidence Stops | Artemis Labs
Outside HIV-associated lipodystrophy, tesamorelin research collapses to single small trials, re-analyses and nulls: one obesity cohort published twice, one liver trial, a split cognition…
Read article →ArticleTesamorelin and Liver Fat: One Trial, Many Papers | Artemis Labs
The tesamorelin liver-fat record is one 61-patient trial in people with HIV, published in Lancet HIV 2019 with the word "might", and at least…
Read article →ArticleTesamorelin and Ipamorelin Together: What the Record Contains | Artemis Labs
Tesamorelin and ipamorelin act on two different receptors and are sold together as a blend. The published record contains zero studies of the two…
Read article →ArticleTesamorelin Human Trials: What the Phase 3 Record Shows | Artemis Labs
The tesamorelin human trial record: two Phase 3 trials in HIV-associated lipodystrophy, a pooled analysis of 806 patients, two 2026 meta-analyses that disagree, and…
Read article →ArticleTesamorelin After Discontinuation: The Reversal Finding | Artemis Labs
What the tesamorelin trial program reported when treatment stopped: visceral fat reaccumulated, effects did not last beyond treatment, and discontinuation risk was roughly doubled…
Read article →ArticleTesamorelin and Cognition: One Positive, Then Two Nulls | Artemis Labs
The tesamorelin cognition record: a 2012 trial in 152 older adults reported a favorable effect, never replicated; a 2025 Phase 2 trial and a…
Read article →ArticleReading a Tesamorelin COA: The Identity Checks That Matter | Artemis Labs
How to read a certificate of analysis for tesamorelin, a 5.1 kDa modified 44-residue peptide: which mass and identifiers a correct sheet shows, and…
Read article →ArticleIs Tesamorelin FDA-Approved? What Application 022505 Covers | Artemis Labs
An FDA-approved tesamorelin product exists: EGRIFTA, by Theratechnologies, application 022505, a Purple Book biologic. What that approval covers, why an Orange Book search misses…
Read article →ArticleCJC-1295 vs Sermorelin: GHRH Comparison 2026
Side-by-side comparison of CJC-1295 (DAC-modified GHRH) and Sermorelin (native GHRH 1-29) — pharmacokinetics, pulsatility, receptor complementarity, and research applications.
Read article →ArticleGrowth Hormone Research Peptides 2026
Pillar guide to GH-axis research peptides — CJC-1295, Ipamorelin, Sermorelin, Tesamorelin, MOTS-C — covering 2024–2026 trial data and comparative pharmacology.
Read article →Related Products
Secretagogues (GHRH & GHS)
What question does this field ask?
How is pulsatile GH secretion controlled, and what changes when one input is altered? The pituitary releases GH in bursts, mostly at night. GHRH sets the bursts; ghrelin, through the GHS-R1a receptor, adds to them; somatostatin holds them back. A study in this field changes one input and reads the pulse pattern and the IGF-1 that follows. Because the pulses are short, sampling frequency decides what a paper can see, and the articles here note how often blood was drawn.
Which compounds appear, and why?
Sermorelin and tesamorelin are GHRH analogs of different lengths, 29 and 44 residues, and ipamorelin is a five-residue ghrelin-receptor agonist chosen in 1998 for not raising ACTH or cortisol. The three cover both inputs to the axis, which is why they sit together here and not only under the product class. CJC-1295 with DAC belongs to the product class but has too few field-level studies to be tagged here yet.
What do the studies measure?
Serum GH over time, IGF-1, receptor selectivity and, in newer work, GHRH signaling in tissues outside the pituitary, such as a 2026 mouse study of amyloid deposition. Human clinical-pharmacology papers exist for the GHRH analogs, including a 2026 meta-analysis of tesamorelin trials in one defined patient group; the ipamorelin record is mostly animal plus one discontinued clinical program.
How do the compounds compare?
| Compound | What it is | Sequence / formula | Molecular weight | Sources cited on its page |
|---|---|---|---|---|
| Sermorelin | GHRH(1–29) amide, 29 amino acids | YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH₂ | 3,357.9 g/mol | 11 |
| Tesamorelin | GHRH(1–44) analog with an N-terminal trans-3-hexenoyl group | modified GHRH(1–44) | 5,135.9 g/mol | 11 |
| Ipamorelin | 5-residue ghrelin-receptor (GHS-R1a) agonist | Aib-His-D-2-Nal-D-Phe-Lys-NH₂ | 711.9 g/mol | 14 |
Sequences and molecular weights are the values verified on each product page. "Sources cited" is the count shown on that page on 28 August 2026.
Where do I read more?
Every compound on this page is supplied for laboratory research only. Each product page carries its full reference list.
References
- Raun K et al. (1998). Ipamorelin, the first selective growth hormone secretagogue. Eur J Endocrinol. PMID 9849822
- Badran AS et al. (2026). Body composition, hepatic fat, metabolic and safety outcomes of tesamorelin, a GHRH analogue, in HIV-associated lipodystrophy: meta-analysis. Obes Res Clin Pract. PMID 41545261
- Pedrolli F et al. (2026). Growth hormone-releasing hormone attenuates amyloid deposition and neuroinflammation in Alzheimer's disease models. Cell Death Dis. PMID 41946684